PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G036000.1
Common NamePHAVU_003G036000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family CO-like
Protein Properties Length: 385aa    MW: 43360.1 Da    PI: 8.5382
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G036000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.56.3e-091659339
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg.......Htv 39
                        +r C+ + +++++++C  ++ +lC+ C ++ H+        H+v
  Phvul.003G036000.1 16 ARACDSCIRNRARWYCAADDAFLCQACDSSVHSAnplarrhHRV 59
                        578*****************************668888886655 PP

2CCT67.24.6e-23323366144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea+++RY+eKr++R+F+KkirYe+RK +Ae+RpR+KGrFvk++
  Phvul.003G036000.1 323 REARVSRYREKRRKRLFSKKIRYEVRKLNAEKRPRMKGRFVKRP 366
                         9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.7221461IPR000315B-box-type zinc finger
SMARTSM003361.2E-91461IPR000315B-box-type zinc finger
PfamPF006436.2E-71658IPR000315B-box-type zinc finger
CDDcd000211.33E-91761No hitNo description
PROSITE profilePS5101716.013323365IPR010402CCT domain
PfamPF062039.3E-18323365IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MSSTKNKGNA VGAKTARACD SCIRNRARWY CAADDAFLCQ ACDSSVHSAN PLARRHHRVR  60
LKIVSHIEAN KKSFSGTGNG PSWHKGFTKK PRTPRHGKNG NKALKNPFDV VPEDTNSNSH  120
EESVDEVLYR VPATPSAEQG VSVSDERRVD LLGCESAFEI AFSADVESLL REGLESECVG  180
MEELGLVGTD EVEEHASWEC CVGGGNMKVE EEAYELGFDC GHELNFSLTC EEVKEKVIGL  240
DKRQEVVKED DQRKKKKILL LRLDYEAVIT AWTSQRSLWT TSHKPDLGTT QFWPHCMRTC  300
GVEFEHRSGE LFGCDAAMAD GGREARVSRY REKRRKRLFS KKIRYEVRKL NAEKRPRMKG  360
RFVKRPSLAT PPIFPLLNKK EERV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1334349RKRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153446.10.0hypothetical protein PHAVU_003G036000g
TrEMBLV7C8400.0V7C840_PHAVU; Uncharacterized protein
STRINGGLYMA10G42090.11e-128(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.18e-66B-box type zinc finger protein with CCT domain